Class a: All alpha proteins [46456] (286 folds) |
Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily) multihelical; consists of two different 3-helical domains connected by a long, partly helical linker |
Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) automatically mapped to Pfam PF01280 |
Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein) |
Protein Ribosomal protein L19 (L19e) [48142] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries) Uniprot P14119 |
Domain d3ccsp1: 3ccs P:1-143 [156417] Other proteins in same PDB: d3ccs11, d3ccs21, d3ccs31, d3ccsb1, d3ccsd1, d3ccsf1, d3ccsh1, d3ccsi1, d3ccsj1, d3ccsk1, d3ccsl1, d3ccsn1, d3ccso1, d3ccsq1, d3ccsr1, d3ccss1, d3ccst1, d3ccsu1, d3ccsv1, d3ccsw1, d3ccsx1, d3ccsy1, d3ccsz1 automatically matched to d1s72p_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccs (more details), 2.95 Å
SCOPe Domain Sequences for d3ccsp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccsp1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]} tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr dlydkagggefdsvadleryida
Timeline for d3ccsp1: