SCOPe 2.05: Domain d3ccsp1: 3ccs P:1-143

Lineage for d3ccsp1 (3ccs P:1-143)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
   multihelical; consists of two different 3-helical domains connected by a long, partly helical linker

4. Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family)
   automatically mapped to Pfam PF01280

5. Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)

6. Protein Ribosomal protein L19 (L19e) [48142] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
   Uniprot P14119

8. Domain d3ccsp1: 3ccs P:1-143 [156417]
   Other proteins in same PDB: d3ccs11, d3ccs21, d3ccs31, d3ccsb1, d3ccsd1, d3ccsf1, d3ccsh1, d3ccsi1, d3ccsj1, d3ccsk1, d3ccsl1, d3ccsn1, d3ccso1, d3ccsq1, d3ccsr1, d3ccss1, d3ccst1, d3ccsu1, d3ccsv1, d3ccsw1, d3ccsx1, d3ccsy1, d3ccsz1
   automatically matched to d1s72p_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccsp1

PDB Entry: 3ccs, 2.95 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482a

PDB Compounds: (P:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d3ccsp1:

Sequence; same for both SEQRES and ATOM records:

>d3ccsp1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

Timeline for d3ccsp1:

• d3ccsp1 first appeared in SCOP 1.75
  
• d3ccsp1 appears in SCOPe 2.04
  
• d3ccsp1 appears in SCOPe 2.06
  
• d3ccsp1 appears in the current release, SCOPe 2.08