SCOPe 2.08: Domain d1phna_: 1phn A:

Lineage for d1phna_ (1phn A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycocyanin alpha subunit [88933] (10 species)

7. Species Red alga (Cyanidium caldarium) [TaxId:2771] [88934] (1 PDB entry)

8. Domain d1phna_: 1phn A: [15641]
   Other proteins in same PDB: d1phnb_
   complexed with cyc, peb

Details for d1phna_

PDB Entry: 1phn, 1.65 Å

PDB Description: structure of phycocyanin from cyanidium caldarium at 1.65a resolution

PDB Compounds: (A:) phycocyanin

SCOPe Domain Sequences for d1phna_:

Sequence; same for both SEQRES and ATOM records:

>d1phna_ a.1.1.3 (A:) Phycocyanin alpha subunit {Red alga (Cyanidium caldarium) [TaxId: 2771]}
mktpiteaiaaadnqgrflsntelqavngryqraaasleaarsltsnaerlingaaqavy
skfpytsqmpgpqyassavgkakcardigyylrmvtyclvvggtgpmdeyliagleeinr
tfdlspswyvealnyikanhglsgqaaneantyidyainals

Timeline for d1phna_:

• d1phna_ first appeared (with stable ids) in SCOP 1.55
  
• d1phna_ appears in SCOPe 2.07