![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
![]() | Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) ![]() |
![]() | Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein) contains irregular N-terminal extension to the common fold |
![]() | Protein Ribosomal protein L32e [52044] (1 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries) Uniprot P12736 |
![]() | Domain d3ccry1: 3ccr Y:95-236 [156402] Other proteins in same PDB: d3ccr11, d3ccr21, d3ccr31, d3ccrb1, d3ccrd1, d3ccrf1, d3ccrh1, d3ccri1, d3ccrj1, d3ccrk1, d3ccrl1, d3ccrn1, d3ccro1, d3ccrp1, d3ccrq1, d3ccrr1, d3ccrs1, d3ccrt1, d3ccru1, d3ccrv1, d3ccrw1, d3ccrx1, d3ccrz1 automatically matched to d1jj2x_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccr (more details), 3 Å
SCOPe Domain Sequences for d3ccry1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccry1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]} telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr erieeeaedagirvlnptyvev
Timeline for d3ccry1: