Lineage for d3ccru1 (3ccr U:4-56)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2648151Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2648286Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2648433Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 2648668Domain d3ccru1: 3ccr U:4-56 [156398]
    Other proteins in same PDB: d3ccr21, d3ccrb1, d3ccrf1, d3ccrh1, d3ccri1, d3ccrp1, d3ccrr1, d3ccrs1, d3ccry1, d3ccrz1
    automatically matched to d1w2bt_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccru1

PDB Entry: 3ccr (more details), 3 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
PDB Compounds: (U:) 50S ribosomal protein L24e

SCOPe Domain Sequences for d3ccru1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccru1 i.1.1.2 (U:4-56) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOPe Domain Coordinates for d3ccru1:

Click to download the PDB-style file with coordinates for d3ccru1.
(The format of our PDB-style files is described here.)

Timeline for d3ccru1: