SCOPe 2.01: Domain d3ccru1: 3ccr U:4-56

Lineage for d3ccru1 (3ccr U:4-56)

1. Root: SCOPe 2.01

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (1 protein)

6. Protein 50S subunit [58125] (6 species)

7. Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)

8. Domain d3ccru1: 3ccr U:4-56 [156398]
   Other proteins in same PDB: d3ccr21, d3ccrb1, d3ccrf1, d3ccrh1, d3ccri1, d3ccrp1, d3ccrr1, d3ccrs1, d3ccry1, d3ccrz1
   automatically matched to d1w2bt_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccru1

PDB Entry: 3ccr, 3 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.

PDB Compounds: (U:) 50S ribosomal protein L24e

SCOPe Domain Sequences for d3ccru1:

Sequence; same for both SEQRES and ATOM records:

>d3ccru1 i.1.1.2 (U:4-56) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

Timeline for d3ccru1:

• d3ccru1 first appeared in SCOP 1.75
  
• d3ccru1 appears in SCOPe 2.02
  
• d3ccru1 appears in the current release, SCOPe 2.08