Lineage for d3ccrs1 (3ccr S:1-81)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536709Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 2536710Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 2536711Family d.12.1.1: L23p [54190] (1 protein)
    automatically mapped to Pfam PF00276
  6. 2536712Protein Ribosomal protein L23 [54191] (4 species)
  7. 2536751Species Haloarcula marismortui [TaxId:2238] [54192] (58 PDB entries)
    Uniprot P12732
  8. 2536806Domain d3ccrs1: 3ccr S:1-81 [156396]
    Other proteins in same PDB: d3ccr11, d3ccr21, d3ccr31, d3ccrb1, d3ccrd1, d3ccrf1, d3ccrh1, d3ccri1, d3ccrj1, d3ccrk1, d3ccrl1, d3ccrn1, d3ccro1, d3ccrp1, d3ccrq1, d3ccrr1, d3ccrt1, d3ccru1, d3ccrv1, d3ccrw1, d3ccrx1, d3ccry1, d3ccrz1
    automatically matched to d1jj2r_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccrs1

PDB Entry: 3ccr (more details), 3 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
PDB Compounds: (S:) 50S ribosomal protein L23P

SCOPe Domain Sequences for d3ccrs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccrs1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

SCOPe Domain Coordinates for d3ccrs1:

Click to download the PDB-style file with coordinates for d3ccrs1.
(The format of our PDB-style files is described here.)

Timeline for d3ccrs1: