Lineage for d3ccrd1 (3ccr D:10-174)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2269333Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2269468Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2269615Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 2269884Domain d3ccrd1: 3ccr D:10-174 [156384]
    Other proteins in same PDB: d3ccr21, d3ccrb1, d3ccrf1, d3ccrh1, d3ccri1, d3ccrp1, d3ccrr1, d3ccrs1, d3ccry1, d3ccrz1
    automatically matched to d1w2bd_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccrd1

PDB Entry: 3ccr (more details), 3 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
PDB Compounds: (D:) 50S ribosomal protein L5P

SCOPe Domain Sequences for d3ccrd1:

Sequence, based on SEQRES records: (download)

>d3ccrd1 i.1.1.2 (D:10-174) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d3ccrd1 i.1.1.2 (D:10-174) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOPe Domain Coordinates for d3ccrd1:

Click to download the PDB-style file with coordinates for d3ccrd1.
(The format of our PDB-style files is described here.)

Timeline for d3ccrd1: