Lineage for d1ew6b_ (1ew6 B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 31Protein Dehaloperoxidase [46530] (1 species)
  7. 32Species Marine worm (Amphitrite ornata) [46531] (2 PDB entries)
  8. 34Domain d1ew6b_: 1ew6 B: [15638]

Details for d1ew6b_

PDB Entry: 1ew6 (more details), 1.78 Å

PDB Description: the crystal structure and amino acid sequence of dehaloperoxidase from amphitrite ornata indicate common ancestry with globins

SCOP Domain Sequences for d1ew6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ew6b_ a.1.1.2 (B:) Dehaloperoxidase {Marine worm (Amphitrite ornata)}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOP Domain Coordinates for d1ew6b_:

Click to download the PDB-style file with coordinates for d1ew6b_.
(The format of our PDB-style files is described here.)

Timeline for d1ew6b_: