Lineage for d3ccqz1 (3ccq Z:35-106)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 893376Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 893377Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
  6. 893378Protein Ribosomal protein L37ae [57831] (1 species)
  7. 893379Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
    Uniprot P60619
  8. 893409Domain d3ccqz1: 3ccq Z:35-106 [156379]
    Other proteins in same PDB: d3ccq11, d3ccq21, d3ccq31, d3ccqb1, d3ccqd1, d3ccqf1, d3ccqh1, d3ccqi1, d3ccqj1, d3ccqk1, d3ccql1, d3ccqn1, d3ccqo1, d3ccqp1, d3ccqq1, d3ccqr1, d3ccqs1, d3ccqt1, d3ccqu1, d3ccqv1, d3ccqw1, d3ccqx1, d3ccqy1
    automatically matched to d1s72z_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant

Details for d3ccqz1

PDB Entry: 3ccq (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOP Domain Sequences for d3ccqz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccqz1 g.41.8.1 (Z:35-106) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
sgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsyk
petpggktvrrs

SCOP Domain Coordinates for d3ccqz1:

Click to download the PDB-style file with coordinates for d3ccqz1.
(The format of our PDB-style files is described here.)

Timeline for d3ccqz1: