SCOPe 2.04: Domain d3ccqy1: 3ccq Y:95-236

Lineage for d3ccqy1 (3ccq Y:95-236)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family)

5. Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
   contains irregular N-terminal extension to the common fold

6. Protein Ribosomal protein L32e [52044] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
   Uniprot P12736

8. Domain d3ccqy1: 3ccq Y:95-236 [156378]
   Other proteins in same PDB: d3ccq11, d3ccq21, d3ccq31, d3ccqb1, d3ccqd1, d3ccqf1, d3ccqh1, d3ccqi1, d3ccqj1, d3ccqk1, d3ccql1, d3ccqn1, d3ccqo1, d3ccqp1, d3ccqq1, d3ccqr1, d3ccqs1, d3ccqt1, d3ccqu1, d3ccqv1, d3ccqw1, d3ccqx1, d3ccqz1
   automatically matched to d1jj2x_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccqy1

PDB Entry: 3ccq, 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u

PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d3ccqy1:

Sequence; same for both SEQRES and ATOM records:

>d3ccqy1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

Timeline for d3ccqy1:

• d3ccqy1 first appeared in SCOP 1.75
  
• d3ccqy1 appears in SCOPe 2.03
  
• d3ccqy1 appears in SCOPe 2.05
  
• d3ccqy1 appears in the current release, SCOPe 2.08