Lineage for d3ccqx1 (3ccq X:7-88)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2648151Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2648286Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2648433Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 2648616Domain d3ccqx1: 3ccq X:7-88 [156377]
    Other proteins in same PDB: d3ccq21, d3ccqb1, d3ccqf1, d3ccqh1, d3ccqi1, d3ccqp1, d3ccqr1, d3ccqs1, d3ccqy1, d3ccqz1
    automatically matched to d1w2bw_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccqx1

PDB Entry: 3ccq (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
PDB Compounds: (X:) 50S ribosomal protein L31e

SCOPe Domain Sequences for d3ccqx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccqx1 i.1.1.2 (X:7-88) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOPe Domain Coordinates for d3ccqx1:

Click to download the PDB-style file with coordinates for d3ccqx1.
(The format of our PDB-style files is described here.)

Timeline for d3ccqx1: