SCOPe 2.05: Domain d3ccqs1: 3ccq S:1-81

Lineage for d3ccqs1 (3ccq S:1-81)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.1: L23p [54190] (1 protein)
   automatically mapped to Pfam PF00276

6. Protein Ribosomal protein L23 [54191] (4 species)

7. Species Haloarcula marismortui [TaxId:2238] [54192] (58 PDB entries)
   Uniprot P12732

8. Domain d3ccqs1: 3ccq S:1-81 [156372]
   Other proteins in same PDB: d3ccq11, d3ccq21, d3ccq31, d3ccqb1, d3ccqd1, d3ccqf1, d3ccqh1, d3ccqi1, d3ccqj1, d3ccqk1, d3ccql1, d3ccqn1, d3ccqo1, d3ccqp1, d3ccqq1, d3ccqr1, d3ccqt1, d3ccqu1, d3ccqv1, d3ccqw1, d3ccqx1, d3ccqy1, d3ccqz1
   automatically matched to d1jj2r_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccqs1

PDB Entry: 3ccq, 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u

PDB Compounds: (S:) 50S ribosomal protein L23P

SCOPe Domain Sequences for d3ccqs1:

Sequence; same for both SEQRES and ATOM records:

>d3ccqs1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

Timeline for d3ccqs1:

• d3ccqs1 first appeared in SCOP 1.75
  
• d3ccqs1 appears in SCOPe 2.04
  
• d3ccqs1 appears in SCOPe 2.06
  
• d3ccqs1 appears in the current release, SCOPe 2.08