Lineage for d1ew6a_ (1ew6 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 530539Protein Dehaloperoxidase [46530] (1 species)
  7. 530540Species Marine worm (Amphitrite ornata) [46531] (2 PDB entries)
  8. 530541Domain d1ew6a_: 1ew6 A: [15637]

Details for d1ew6a_

PDB Entry: 1ew6 (more details), 1.78 Å

PDB Description: the crystal structure and amino acid sequence of dehaloperoxidase from amphitrite ornata indicate common ancestry with globins

SCOP Domain Sequences for d1ew6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ew6a_ a.1.1.2 (A:) Dehaloperoxidase {Marine worm (Amphitrite ornata)}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOP Domain Coordinates for d1ew6a_:

Click to download the PDB-style file with coordinates for d1ew6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ew6a_: