![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily) multihelical; consists of two different 3-helical domains connected by a long, partly helical linker |
![]() | Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) ![]() automatically mapped to Pfam PF01280 |
![]() | Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein) |
![]() | Protein Ribosomal protein L19 (L19e) [48142] (1 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries) Uniprot P14119 |
![]() | Domain d3ccqp1: 3ccq P:1-143 [156369] Other proteins in same PDB: d3ccq11, d3ccq21, d3ccq31, d3ccqb1, d3ccqd1, d3ccqf1, d3ccqh1, d3ccqi1, d3ccqj1, d3ccqk1, d3ccql1, d3ccqn1, d3ccqo1, d3ccqq1, d3ccqr1, d3ccqs1, d3ccqt1, d3ccqu1, d3ccqv1, d3ccqw1, d3ccqx1, d3ccqy1, d3ccqz1 automatically matched to d1s72p_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccq (more details), 2.9 Å
SCOPe Domain Sequences for d3ccqp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccqp1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]} tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr dlydkagggefdsvadleryida
Timeline for d3ccqp1: