Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (1 protein) |
Protein 50S subunit [58125] (6 species) |
Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
Domain d3ccqo1: 3ccq O:1-115 [156368] Other proteins in same PDB: d3ccq21, d3ccqb1, d3ccqf1, d3ccqh1, d3ccqi1, d3ccqp1, d3ccqr1, d3ccqs1, d3ccqy1, d3ccqz1 automatically matched to d1w2bn_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccq (more details), 2.9 Å
SCOPe Domain Sequences for d3ccqo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccqo1 i.1.1.2 (O:1-115) 50S subunit {Haloarcula marismortui [TaxId: 2238]} sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir
Timeline for d3ccqo1: