Lineage for d3ccql1 (3ccq L:1-150)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 897176Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 897177Protein 50S subunit [58125] (6 species)
  7. 897178Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 897312Domain d3ccql1: 3ccq L:1-150 [156366]
    Other proteins in same PDB: d3ccq21, d3ccqb1, d3ccqf1, d3ccqh1, d3ccqi1, d3ccqp1, d3ccqr1, d3ccqs1, d3ccqy1, d3ccqz1
    automatically matched to d1w2bk_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant

Details for d3ccql1

PDB Entry: 3ccq (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
PDB Compounds: (L:) 50S ribosomal protein L15P

SCOP Domain Sequences for d3ccql1:

Sequence, based on SEQRES records: (download)

>d3ccql1 i.1.1.2 (L:1-150) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
iaddfsegarekvegaggsveltdlgeerq

Sequence, based on observed residues (ATOM records): (download)

>d3ccql1 i.1.1.2 (L:1-150) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
segarekvegaggsveltdlgeerq

SCOP Domain Coordinates for d3ccql1:

Click to download the PDB-style file with coordinates for d3ccql1.
(The format of our PDB-style files is described here.)

Timeline for d3ccql1: