Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) |
Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein) |
Protein Ribosomal protein L10e [54688] (2 species) |
Species Haloarcula marismortui [TaxId:2238] [54689] (58 PDB entries) Uniprot P60617 |
Domain d3ccqh1: 3ccq H:4-166 [156362] Other proteins in same PDB: d3ccq11, d3ccq21, d3ccq31, d3ccqb1, d3ccqd1, d3ccqf1, d3ccqi1, d3ccqj1, d3ccqk1, d3ccql1, d3ccqn1, d3ccqo1, d3ccqp1, d3ccqq1, d3ccqr1, d3ccqs1, d3ccqt1, d3ccqu1, d3ccqv1, d3ccqw1, d3ccqx1, d3ccqy1, d3ccqz1 automatically matched to d1s72h_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccq (more details), 2.9 Å
SCOPe Domain Sequences for d3ccqh1:
Sequence, based on SEQRES records: (download)
>d3ccqh1 d.41.4.1 (H:4-166) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]} kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkqatgagadrvsdgmraafgki vgtaarvqageqlftaycnvedaehvkeafrraynkitpscri
>d3ccqh1 d.41.4.1 (H:4-166) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]} kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkdgmraafgkivgtaarvqage qlftaycnvedaehvkeafrraynkitpscri
Timeline for d3ccqh1: