Lineage for d1cqxb1 (1cqx B:1-150)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1074991Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1075100Protein Flavohemoglobin, N-terminal domain [46528] (2 species)
  7. 1075101Species Alcaligenes eutrophus [TaxId:106590] [46529] (1 PDB entry)
  8. 1075103Domain d1cqxb1: 1cqx B:1-150 [15636]
    Other proteins in same PDB: d1cqxa2, d1cqxa3, d1cqxb2, d1cqxb3
    complexed with dgg, fad, hem, na

Details for d1cqxb1

PDB Entry: 1cqx (more details), 1.75 Å

PDB Description: crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution
PDB Compounds: (B:) flavohemoprotein

SCOPe Domain Sequences for d1cqxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqxb1 a.1.1.2 (B:1-150) Flavohemoglobin, N-terminal domain {Alcaligenes eutrophus [TaxId: 106590]}
mltqktkdivkatapvlaehgydiikcfyqrmfeahpelknvfnmahqeqgqqqqalara
vyayaeniedpnslmavlkniankhaslgvkpeqypivgehllaaikevlgnaatddiis
awaqaygnladvlmgmeselyersaeqpgg

SCOPe Domain Coordinates for d1cqxb1:

Click to download the PDB-style file with coordinates for d1cqxb1.
(The format of our PDB-style files is described here.)

Timeline for d1cqxb1: