Lineage for d3ccq31 (3ccq 3:1-92)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1711204Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1711205Protein 50S subunit [58125] (6 species)
  7. 1711354Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1711512Domain d3ccq31: 3ccq 3:1-92 [156358]
    Other proteins in same PDB: d3ccq21, d3ccqb1, d3ccqf1, d3ccqh1, d3ccqi1, d3ccqp1, d3ccqr1, d3ccqs1, d3ccqy1, d3ccqz1
    automatically matched to d1w2b2_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccq31

PDB Entry: 3ccq (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
PDB Compounds: (3:) 50S ribosomal protein L44E

SCOPe Domain Sequences for d3ccq31:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccq31 i.1.1.2 (3:1-92) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOPe Domain Coordinates for d3ccq31:

Click to download the PDB-style file with coordinates for d3ccq31.
(The format of our PDB-style files is described here.)

Timeline for d3ccq31: