SCOPe 2.07: Domain d3ccmz1: 3ccm Z:35-106

Lineage for d3ccmz1 (3ccm Z:35-106)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
   automatically mapped to Pfam PF01780

6. Protein Ribosomal protein L37ae [57831] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
   Uniprot P60619

8. Domain d3ccmz1: 3ccm Z:35-106 [156355]
   Other proteins in same PDB: d3ccm11, d3ccm21, d3ccm31, d3ccmb1, d3ccmd1, d3ccmf1, d3ccmh1, d3ccmi1, d3ccmj1, d3ccmk1, d3ccml1, d3ccmn1, d3ccmo1, d3ccmp1, d3ccmq1, d3ccmr1, d3ccms1, d3ccmt1, d3ccmu1, d3ccmv1, d3ccmw1, d3ccmx1, d3ccmy1
   automatically matched to d1s72z_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccmz1

PDB Entry: 3ccm, 2.55 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u

PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOPe Domain Sequences for d3ccmz1:

Sequence; same for both SEQRES and ATOM records:

>d3ccmz1 g.41.8.1 (Z:35-106) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
sgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsyk
petpggktvrrs

Timeline for d3ccmz1:

• d3ccmz1 first appeared in SCOP 1.75
  
• d3ccmz1 appears in SCOPe 2.06
  
• d3ccmz1 appears in the current release, SCOPe 2.08