SCOPe 2.02: Domain d3ccmy1: 3ccm Y:95-236

Lineage for d3ccmy1 (3ccm Y:95-236)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family)

5. Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
   contains irregular N-terminal extension to the common fold

6. Protein Ribosomal protein L32e [52044] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
   Uniprot P12736

8. Domain d3ccmy1: 3ccm Y:95-236 [156354]
   Other proteins in same PDB: d3ccm11, d3ccm21, d3ccm31, d3ccmb1, d3ccmd1, d3ccmf1, d3ccmh1, d3ccmi1, d3ccmj1, d3ccmk1, d3ccml1, d3ccmn1, d3ccmo1, d3ccmp1, d3ccmq1, d3ccmr1, d3ccms1, d3ccmt1, d3ccmu1, d3ccmv1, d3ccmw1, d3ccmx1, d3ccmz1
   automatically matched to d1jj2x_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccmy1

PDB Entry: 3ccm, 2.55 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u

PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d3ccmy1:

Sequence; same for both SEQRES and ATOM records:

>d3ccmy1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

Timeline for d3ccmy1:

• d3ccmy1 first appeared in SCOP 1.75
  
• d3ccmy1 appears in SCOPe 2.01
  
• d3ccmy1 appears in SCOPe 2.03
  
• d3ccmy1 appears in the current release, SCOPe 2.08