Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Flavohemoglobin, N-terminal domain [46528] (2 species) |
Species Alcaligenes eutrophus [TaxId:106590] [46529] (1 PDB entry) |
Domain d1cqxa1: 1cqx A:1-150 [15635] Other proteins in same PDB: d1cqxa2, d1cqxa3, d1cqxb2, d1cqxb3 complexed with dgg, fad, hem, na |
PDB Entry: 1cqx (more details), 1.75 Å
SCOPe Domain Sequences for d1cqxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqxa1 a.1.1.2 (A:1-150) Flavohemoglobin, N-terminal domain {Alcaligenes eutrophus [TaxId: 106590]} mltqktkdivkatapvlaehgydiikcfyqrmfeahpelknvfnmahqeqgqqqqalara vyayaeniedpnslmavlkniankhaslgvkpeqypivgehllaaikevlgnaatddiis awaqaygnladvlmgmeselyersaeqpgg
Timeline for d1cqxa1: