Lineage for d1cqxa1 (1cqx A:1-150)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1473278Protein Flavohemoglobin, N-terminal domain [46528] (2 species)
  7. 1473279Species Alcaligenes eutrophus [TaxId:106590] [46529] (1 PDB entry)
  8. 1473280Domain d1cqxa1: 1cqx A:1-150 [15635]
    Other proteins in same PDB: d1cqxa2, d1cqxa3, d1cqxb2, d1cqxb3
    complexed with dgg, fad, hem, na

Details for d1cqxa1

PDB Entry: 1cqx (more details), 1.75 Å

PDB Description: crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution
PDB Compounds: (A:) flavohemoprotein

SCOPe Domain Sequences for d1cqxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqxa1 a.1.1.2 (A:1-150) Flavohemoglobin, N-terminal domain {Alcaligenes eutrophus [TaxId: 106590]}
mltqktkdivkatapvlaehgydiikcfyqrmfeahpelknvfnmahqeqgqqqqalara
vyayaeniedpnslmavlkniankhaslgvkpeqypivgehllaaikevlgnaatddiis
awaqaygnladvlmgmeselyersaeqpgg

SCOPe Domain Coordinates for d1cqxa1:

Click to download the PDB-style file with coordinates for d1cqxa1.
(The format of our PDB-style files is described here.)

Timeline for d1cqxa1: