SCOPe 2.07: Domain d3ccms1: 3ccm S:1-81

Lineage for d3ccms1 (3ccm S:1-81)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.1: L23p [54190] (1 protein)
   automatically mapped to Pfam PF00276

6. Protein Ribosomal protein L23 [54191] (4 species)

7. Species Haloarcula marismortui [TaxId:2238] [54192] (58 PDB entries)
   Uniprot P12732

8. Domain d3ccms1: 3ccm S:1-81 [156348]
   Other proteins in same PDB: d3ccm11, d3ccm21, d3ccm31, d3ccmb1, d3ccmd1, d3ccmf1, d3ccmh1, d3ccmi1, d3ccmj1, d3ccmk1, d3ccml1, d3ccmn1, d3ccmo1, d3ccmp1, d3ccmq1, d3ccmr1, d3ccmt1, d3ccmu1, d3ccmv1, d3ccmw1, d3ccmx1, d3ccmy1, d3ccmz1
   automatically matched to d1jj2r_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccms1

PDB Entry: 3ccm, 2.55 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u

PDB Compounds: (S:) 50S ribosomal protein L23P

SCOPe Domain Sequences for d3ccms1:

Sequence; same for both SEQRES and ATOM records:

>d3ccms1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

Timeline for d3ccms1:

• d3ccms1 first appeared in SCOP 1.75
  
• d3ccms1 appears in SCOPe 2.06
  
• d3ccms1 appears in the current release, SCOPe 2.08