SCOPe 2.04: Domain d3ccmp1: 3ccm P:1-143

Lineage for d3ccmp1 (3ccm P:1-143)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
   multihelical; consists of two different 3-helical domains connected by a long, partly helical linker

4. Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family)
   automatically mapped to Pfam PF01280

5. Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)

6. Protein Ribosomal protein L19 (L19e) [48142] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
   Uniprot P14119

8. Domain d3ccmp1: 3ccm P:1-143 [156345]
   Other proteins in same PDB: d3ccm11, d3ccm21, d3ccm31, d3ccmb1, d3ccmd1, d3ccmf1, d3ccmh1, d3ccmi1, d3ccmj1, d3ccmk1, d3ccml1, d3ccmn1, d3ccmo1, d3ccmq1, d3ccmr1, d3ccms1, d3ccmt1, d3ccmu1, d3ccmv1, d3ccmw1, d3ccmx1, d3ccmy1, d3ccmz1
   automatically matched to d1s72p_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccmp1

PDB Entry: 3ccm, 2.55 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u

PDB Compounds: (P:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d3ccmp1:

Sequence; same for both SEQRES and ATOM records:

>d3ccmp1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

Timeline for d3ccmp1:

• d3ccmp1 first appeared in SCOP 1.75
  
• d3ccmp1 appears in SCOPe 2.03
  
• d3ccmp1 appears in SCOPe 2.05
  
• d3ccmp1 appears in the current release, SCOPe 2.08