Lineage for d3ccmo1 (3ccm O:1-115)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1070374Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1070375Protein 50S subunit [58125] (6 species)
  7. 1070524Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1070548Domain d3ccmo1: 3ccm O:1-115 [156344]
    Other proteins in same PDB: d3ccm21, d3ccmb1, d3ccmf1, d3ccmh1, d3ccmi1, d3ccmp1, d3ccmr1, d3ccms1, d3ccmy1, d3ccmz1
    automatically matched to d1w2bn_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccmo1

PDB Entry: 3ccm (more details), 2.55 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
PDB Compounds: (O:) 50S ribosomal protein L18e

SCOPe Domain Sequences for d3ccmo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccmo1 i.1.1.2 (O:1-115) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOPe Domain Coordinates for d3ccmo1:

Click to download the PDB-style file with coordinates for d3ccmo1.
(The format of our PDB-style files is described here.)

Timeline for d3ccmo1: