Lineage for d3ccm21 (3ccm 2:1-49)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2346684Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2346685Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
    automatically mapped to Pfam PF00832
  5. 2346686Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 2346687Protein Ribosomal protein L39e [48664] (1 species)
  7. 2346688Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 2346723Domain d3ccm21: 3ccm 2:1-49 [156333]
    Other proteins in same PDB: d3ccm11, d3ccm31, d3ccmb1, d3ccmd1, d3ccmf1, d3ccmh1, d3ccmi1, d3ccmj1, d3ccmk1, d3ccml1, d3ccmn1, d3ccmo1, d3ccmp1, d3ccmq1, d3ccmr1, d3ccms1, d3ccmt1, d3ccmu1, d3ccmv1, d3ccmw1, d3ccmx1, d3ccmy1, d3ccmz1
    automatically matched to 1VQ4 2:1-49
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccm21

PDB Entry: 3ccm (more details), 2.55 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
PDB Compounds: (2:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d3ccm21:

Sequence, based on SEQRES records: (download)

>d3ccm21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d3ccm21 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

SCOPe Domain Coordinates for d3ccm21:

Click to download the PDB-style file with coordinates for d3ccm21.
(The format of our PDB-style files is described here.)

Timeline for d3ccm21: