Lineage for d3vhba_ (3vhb A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2685967Protein Bacterial dimeric hemoglobin [46526] (1 species)
  7. 2685968Species Vitreoscilla stercoraria [TaxId:61] [46527] (7 PDB entries)
  8. 2685979Domain d3vhba_: 3vhb A: [15633]
    complexed with hem, imd

Details for d3vhba_

PDB Entry: 3vhb (more details), 2.1 Å

PDB Description: imidazole adduct of the bacterial hemoglobin from vitreoscilla sp.
PDB Compounds: (A:) protein (hemoglobin)

SCOPe Domain Sequences for d3vhba_:

Sequence, based on SEQRES records: (download)

>d3vhba_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamtv
laaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddilda
wgkaygviadvfiqveadlyaqav

Sequence, based on observed residues (ATOM records): (download)

>d3vhba_ a.1.1.2 (A:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfqpkalamtvlaaaqnien
lpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygvia
dvfiqveadlyaqav

SCOPe Domain Coordinates for d3vhba_:

Click to download the PDB-style file with coordinates for d3vhba_.
(The format of our PDB-style files is described here.)

Timeline for d3vhba_: