Class i: Low resolution protein structures [58117] (26 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (1 protein) |
Protein 50S subunit [58125] (6 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
Domain d3cclu1: 3ccl U:4-56 [156326] Other proteins in same PDB: d3ccl21, d3cclb1, d3cclf1, d3cclh1, d3ccli1, d3cclp1, d3cclr1, d3ccls1, d3ccly1, d3cclz1 automatically matched to d1w2bt_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant |
PDB Entry: 3ccl (more details), 2.9 Å
SCOP Domain Sequences for d3cclu1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cclu1 i.1.1.2 (U:4-56) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]} recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar
Timeline for d3cclu1: