Lineage for d3cclu1 (3ccl U:4-56)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 897176Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 897177Protein 50S subunit [58125] (6 species)
  7. 897178Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 897261Domain d3cclu1: 3ccl U:4-56 [156326]
    Other proteins in same PDB: d3ccl21, d3cclb1, d3cclf1, d3cclh1, d3ccli1, d3cclp1, d3cclr1, d3ccls1, d3ccly1, d3cclz1
    automatically matched to d1w2bt_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant

Details for d3cclu1

PDB Entry: 3ccl (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
PDB Compounds: (U:) 50S ribosomal protein L24e

SCOP Domain Sequences for d3cclu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cclu1 i.1.1.2 (U:4-56) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOP Domain Coordinates for d3cclu1:

Click to download the PDB-style file with coordinates for d3cclu1.
(The format of our PDB-style files is described here.)

Timeline for d3cclu1: