| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) ![]() |
| Family d.12.1.1: L23p [54190] (1 protein) automatically mapped to Pfam PF00276 |
| Protein Ribosomal protein L23 [54191] (4 species) |
| Species Haloarcula marismortui [TaxId:2238] [54192] (58 PDB entries) Uniprot P12732 |
| Domain d3ccls1: 3ccl S:1-81 [156324] Other proteins in same PDB: d3ccl11, d3ccl21, d3ccl31, d3cclb1, d3ccld1, d3cclf1, d3cclh1, d3ccli1, d3cclj1, d3cclk1, d3ccll1, d3ccln1, d3cclo1, d3cclp1, d3cclq1, d3cclr1, d3cclt1, d3cclu1, d3cclv1, d3cclw1, d3cclx1, d3ccly1, d3cclz1 automatically matched to d1jj2r_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccl (more details), 2.9 Å
SCOPe Domain Sequences for d3ccls1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccls1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri
Timeline for d3ccls1: