Lineage for d3cclp1 (3ccl P:1-143)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1275951Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 1275952Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
    automatically mapped to Pfam PF01280
  5. 1275953Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 1275954Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 1275955Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 1275982Domain d3cclp1: 3ccl P:1-143 [156321]
    Other proteins in same PDB: d3ccl11, d3ccl21, d3ccl31, d3cclb1, d3ccld1, d3cclf1, d3cclh1, d3ccli1, d3cclj1, d3cclk1, d3ccll1, d3ccln1, d3cclo1, d3cclq1, d3cclr1, d3ccls1, d3cclt1, d3cclu1, d3cclv1, d3cclw1, d3cclx1, d3ccly1, d3cclz1
    automatically matched to d1s72p_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cclp1

PDB Entry: 3ccl (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
PDB Compounds: (P:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d3cclp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cclp1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d3cclp1:

Click to download the PDB-style file with coordinates for d3cclp1.
(The format of our PDB-style files is described here.)

Timeline for d3cclp1: