Lineage for d4vhbb_ (4vhb B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1473140Protein Bacterial dimeric hemoglobin [46526] (1 species)
  7. 1473141Species Vitreoscilla stercoraria [TaxId:61] [46527] (7 PDB entries)
  8. 1473145Domain d4vhbb_: 4vhb B: [15632]
    complexed with hem, scn

Details for d4vhbb_

PDB Entry: 4vhb (more details), 1.8 Å

PDB Description: thiocyanate adduct of the bacterial hemoglobin from vitreoscilla sp.
PDB Compounds: (B:) protein (hemoglobin)

SCOPe Domain Sequences for d4vhbb_:

Sequence, based on SEQRES records: (download)

>d4vhbb_ a.1.1.2 (B:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamtv
laaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddilda
wgkaygviadvfiqveadlyaqav

Sequence, based on observed residues (ATOM records): (download)

>d4vhbb_ a.1.1.2 (B:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfleqpkalamtvlaaaqni
enlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygv
iadvfiqveadlyaqav

SCOPe Domain Coordinates for d4vhbb_:

Click to download the PDB-style file with coordinates for d4vhbb_.
(The format of our PDB-style files is described here.)

Timeline for d4vhbb_: