SCOPe 2.08: Domain d4vhbb_: 4vhb B:

Lineage for d4vhbb_ (4vhb B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Bacterial dimeric hemoglobin [46526] (1 species)

7. Species Vitreoscilla stercoraria [TaxId:61] [46527] (7 PDB entries)

8. Domain d4vhbb_: 4vhb B: [15632]
   complexed with hem, scn

Details for d4vhbb_

PDB Entry: 4vhb, 1.8 Å

PDB Description: thiocyanate adduct of the bacterial hemoglobin from vitreoscilla sp.

PDB Compounds: (B:) protein (hemoglobin)

SCOPe Domain Sequences for d4vhbb_:

Sequence, based on SEQRES records:

>d4vhbb_ a.1.1.2 (B:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamtv
laaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddilda
wgkaygviadvfiqveadlyaqav

Sequence, based on observed residues (ATOM records):

>d4vhbb_ a.1.1.2 (B:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfleqpkalamtvlaaaqni
enlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygv
iadvfiqveadlyaqav

Timeline for d4vhbb_:

• d4vhbb_ first appeared (with stable ids) in SCOP 1.55
  
• d4vhbb_ appears in SCOPe 2.07