Lineage for d3cclk1 (3ccl K:1-132)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1249271Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1249272Protein 50S subunit [58125] (6 species)
  7. 1249421Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1249540Domain d3cclk1: 3ccl K:1-132 [156317]
    Other proteins in same PDB: d3ccl21, d3cclb1, d3cclf1, d3cclh1, d3ccli1, d3cclp1, d3cclr1, d3ccls1, d3ccly1, d3cclz1
    automatically matched to d1w2bj_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cclk1

PDB Entry: 3ccl (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
PDB Compounds: (K:) 50S ribosomal protein L14P

SCOPe Domain Sequences for d3cclk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cclk1 i.1.1.2 (K:1-132) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOPe Domain Coordinates for d3cclk1:

Click to download the PDB-style file with coordinates for d3cclk1.
(The format of our PDB-style files is described here.)

Timeline for d3cclk1: