Lineage for d3ccld1 (3ccl D:10-174)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2648151Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2648286Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2648433Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 2648577Domain d3ccld1: 3ccl D:10-174 [156312]
    Other proteins in same PDB: d3ccl21, d3cclb1, d3cclf1, d3cclh1, d3ccli1, d3cclp1, d3cclr1, d3ccls1, d3ccly1, d3cclz1
    automatically matched to d1w2bd_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccld1

PDB Entry: 3ccl (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
PDB Compounds: (D:) 50S ribosomal protein L5P

SCOPe Domain Sequences for d3ccld1:

Sequence, based on SEQRES records: (download)

>d3ccld1 i.1.1.2 (D:10-174) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d3ccld1 i.1.1.2 (D:10-174) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOPe Domain Coordinates for d3ccld1:

Click to download the PDB-style file with coordinates for d3ccld1.
(The format of our PDB-style files is described here.)

Timeline for d3ccld1: