Class g: Small proteins [56992] (94 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) |
Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein) automatically mapped to Pfam PF01780 |
Protein Ribosomal protein L37ae [57831] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries) Uniprot P60619 |
Domain d3ccjz1: 3ccj Z:35-106 [156307] Other proteins in same PDB: d3ccj11, d3ccj21, d3ccj31, d3ccjb1, d3ccjd1, d3ccjf1, d3ccjh1, d3ccji1, d3ccjj1, d3ccjk1, d3ccjl1, d3ccjn1, d3ccjo1, d3ccjp1, d3ccjq1, d3ccjr1, d3ccjs1, d3ccjt1, d3ccju1, d3ccjv1, d3ccjw1, d3ccjx1, d3ccjy1 automatically matched to d1s72z_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccj (more details), 2.7 Å
SCOPe Domain Sequences for d3ccjz1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccjz1 g.41.8.1 (Z:35-106) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]} sgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsyk petpggktvrrs
Timeline for d3ccjz1: