Lineage for d3ccjy1 (3ccj Y:95-236)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851514Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 2851574Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 2851575Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 2851576Protein Ribosomal protein L32e [52044] (1 species)
  7. 2851577Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 2851635Domain d3ccjy1: 3ccj Y:95-236 [156306]
    Other proteins in same PDB: d3ccj11, d3ccj21, d3ccj31, d3ccjb1, d3ccjd1, d3ccjf1, d3ccjh1, d3ccji1, d3ccjj1, d3ccjk1, d3ccjl1, d3ccjn1, d3ccjo1, d3ccjp1, d3ccjq1, d3ccjr1, d3ccjs1, d3ccjt1, d3ccju1, d3ccjv1, d3ccjw1, d3ccjx1, d3ccjz1
    automatically matched to d1jj2x_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccjy1

PDB Entry: 3ccj (more details), 3.3 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d3ccjy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccjy1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOPe Domain Coordinates for d3ccjy1:

Click to download the PDB-style file with coordinates for d3ccjy1.
(The format of our PDB-style files is described here.)

Timeline for d3ccjy1: