Lineage for d3ccjw1 (3ccj W:1-154)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1711204Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1711205Protein 50S subunit [58125] (6 species)
  7. 1711354Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1711509Domain d3ccjw1: 3ccj W:1-154 [156304]
    Other proteins in same PDB: d3ccj21, d3ccjb1, d3ccjf1, d3ccjh1, d3ccji1, d3ccjp1, d3ccjr1, d3ccjs1, d3ccjy1, d3ccjz1
    automatically matched to d1w2bv_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccjw1

PDB Entry: 3ccj (more details), 2.7 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
PDB Compounds: (W:) 50S ribosomal protein L30P

SCOPe Domain Sequences for d3ccjw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccjw1 i.1.1.2 (W:1-154) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOPe Domain Coordinates for d3ccjw1:

Click to download the PDB-style file with coordinates for d3ccjw1.
(The format of our PDB-style files is described here.)

Timeline for d3ccjw1: