SCOP 1.67: Domain d2vhbb_: 2vhb B:

Lineage for d2vhbb_ (2vhb B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (20 proteins)
   Heme-binding protein

6. Protein Bacterial dimeric hemoglobin [46526] (1 species)

7. Species Vitreoscilla stercoraria [TaxId:61] [46527] (4 PDB entries)

8. Domain d2vhbb_: 2vhb B: [15630]
   complexed with azi, hem

Details for d2vhbb_

PDB Entry: 2vhb, 1.76 Å

PDB Description: azide adduct of the bacterial hemoglobin from vitreoscilla stercoraria

SCOP Domain Sequences for d2vhbb_:

Sequence, based on SEQRES records:

>d2vhbb_ a.1.1.2 (B:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfdmgrqesleqpkalamtv
laaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddilda
wgkaygviadvfiqveadlyaqav

Sequence, based on observed residues (ATOM records):

>d2vhbb_ a.1.1.2 (B:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria}
ldqqtiniikatvpvlkehgvtitttfyknlfakhpevrplfleqpkalamtvlaaaqni
enlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildawgkaygv
iadvfiqveadlyaqav

Timeline for d2vhbb_:

• d2vhbb_ first appeared (with stable ids) in SCOP 1.55
  
• d2vhbb_ appears in SCOP 1.65
  
• d2vhbb_ appears in SCOP 1.69
  
• d2vhbb_ appears in the current release, SCOPe 2.08