![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.2: Large subunit [58124] (3 proteins) |
![]() | Protein Prokaryotic (50S subunit) [58125] (3 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
![]() | Domain d3ccjq1: 3ccj Q:1-95 [156298] Other proteins in same PDB: d3ccj21, d3ccjb1, d3ccjf1, d3ccjh1, d3ccji1, d3ccjp1, d3ccjr1, d3ccjs1, d3ccjy1, d3ccjz1 automatically matched to d1w2bp_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccj (more details), 3.3 Å
SCOPe Domain Sequences for d3ccjq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccjq1 i.1.1.2 (Q:1-95) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]} pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt gtvegkqgdaykvdivdggkektiivtaahlrrqe
Timeline for d3ccjq1: