Lineage for d3ccjq1 (3ccj Q:1-95)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3043573Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 3043708Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 3043855Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 3044102Domain d3ccjq1: 3ccj Q:1-95 [156298]
    Other proteins in same PDB: d3ccj21, d3ccjb1, d3ccjf1, d3ccjh1, d3ccji1, d3ccjp1, d3ccjr1, d3ccjs1, d3ccjy1, d3ccjz1
    automatically matched to d1w2bp_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccjq1

PDB Entry: 3ccj (more details), 3.3 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
PDB Compounds: (Q:) 50S ribosomal protein L21e

SCOPe Domain Sequences for d3ccjq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccjq1 i.1.1.2 (Q:1-95) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOPe Domain Coordinates for d3ccjq1:

Click to download the PDB-style file with coordinates for d3ccjq1.
(The format of our PDB-style files is described here.)

Timeline for d3ccjq1: