Class a: All alpha proteins [46456] (289 folds) |
Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily) multihelical; consists of two different 3-helical domains connected by a long, partly helical linker |
Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) automatically mapped to Pfam PF01280 |
Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein) |
Protein Ribosomal protein L19 (L19e) [48142] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries) Uniprot P14119 |
Domain d3ccjp1: 3ccj P:1-143 [156297] Other proteins in same PDB: d3ccj11, d3ccj21, d3ccj31, d3ccjb1, d3ccjd1, d3ccjf1, d3ccjh1, d3ccji1, d3ccjj1, d3ccjk1, d3ccjl1, d3ccjn1, d3ccjo1, d3ccjq1, d3ccjr1, d3ccjs1, d3ccjt1, d3ccju1, d3ccjv1, d3ccjw1, d3ccjx1, d3ccjy1, d3ccjz1 automatically matched to d1s72p_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccj (more details), 2.7 Å
SCOPe Domain Sequences for d3ccjp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccjp1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]} tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr dlydkagggefdsvadleryida
Timeline for d3ccjp1: