Lineage for d3ccjk1 (3ccj K:1-132)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2269333Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2269468Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2269615Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 2269802Domain d3ccjk1: 3ccj K:1-132 [156293]
    Other proteins in same PDB: d3ccj21, d3ccjb1, d3ccjf1, d3ccjh1, d3ccji1, d3ccjp1, d3ccjr1, d3ccjs1, d3ccjy1, d3ccjz1
    automatically matched to d1w2bj_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccjk1

PDB Entry: 3ccj (more details), 2.7 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
PDB Compounds: (K:) 50S ribosomal protein L14P

SCOPe Domain Sequences for d3ccjk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccjk1 i.1.1.2 (K:1-132) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOPe Domain Coordinates for d3ccjk1:

Click to download the PDB-style file with coordinates for d3ccjk1.
(The format of our PDB-style files is described here.)

Timeline for d3ccjk1: