Lineage for d3ccjj1 (3ccj J:4-145)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1971716Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 1971851Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 1971998Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1972114Domain d3ccjj1: 3ccj J:4-145 [156292]
    Other proteins in same PDB: d3ccj21, d3ccjb1, d3ccjf1, d3ccjh1, d3ccji1, d3ccjp1, d3ccjr1, d3ccjs1, d3ccjy1, d3ccjz1
    automatically matched to d1w2bi_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccjj1

PDB Entry: 3ccj (more details), 2.7 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
PDB Compounds: (J:) 50S ribosomal protein L13P

SCOPe Domain Sequences for d3ccjj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccjj1 i.1.1.2 (J:4-145) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOPe Domain Coordinates for d3ccjj1:

Click to download the PDB-style file with coordinates for d3ccjj1.
(The format of our PDB-style files is described here.)

Timeline for d3ccjj1: