| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) ![]() |
| Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) |
| Protein Ribosomal protein L11, C-terminal domain [46908] (6 species) |
| Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries) Uniprot P14122 67-136 |
| Domain d3ccji1: 3ccj I:66-129 [156291] Other proteins in same PDB: d3ccj11, d3ccj21, d3ccj31, d3ccjb1, d3ccjd1, d3ccjf1, d3ccjh1, d3ccjj1, d3ccjk1, d3ccjl1, d3ccjn1, d3ccjo1, d3ccjp1, d3ccjq1, d3ccjr1, d3ccjs1, d3ccjt1, d3ccju1, d3ccjv1, d3ccjw1, d3ccjx1, d3ccjy1, d3ccjz1 automatically matched to d1s72i_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3ccj (more details), 3.3 Å
SCOPe Domain Sequences for d3ccji1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccji1 a.4.7.1 (I:66-129) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tcts
Timeline for d3ccji1: