Lineage for d3ccjf1 (3ccj F:1-119)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201846Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2201847Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2201864Protein Ribosomal protein L7ae [55319] (7 species)
  7. 2201872Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
    Uniprot P12743
  8. 2201924Domain d3ccjf1: 3ccj F:1-119 [156289]
    Other proteins in same PDB: d3ccj11, d3ccj21, d3ccj31, d3ccjb1, d3ccjd1, d3ccjh1, d3ccji1, d3ccjj1, d3ccjk1, d3ccjl1, d3ccjn1, d3ccjo1, d3ccjp1, d3ccjq1, d3ccjr1, d3ccjs1, d3ccjt1, d3ccju1, d3ccjv1, d3ccjw1, d3ccjx1, d3ccjy1, d3ccjz1
    automatically matched to d1s72f_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccjf1

PDB Entry: 3ccj (more details), 2.7 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d3ccjf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccjf1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

SCOPe Domain Coordinates for d3ccjf1:

Click to download the PDB-style file with coordinates for d3ccjf1.
(The format of our PDB-style files is described here.)

Timeline for d3ccjf1: