![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
![]() | Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) ![]() |
![]() | Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein) contains irregular N-terminal extension to the common fold |
![]() | Protein Ribosomal protein L32e [52044] (1 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries) Uniprot P12736 |
![]() | Domain d3ccey1: 3cce Y:95-236 [156282] Other proteins in same PDB: d3cce11, d3cce21, d3cce31, d3cceb1, d3cced1, d3ccef1, d3cceh1, d3ccei1, d3ccej1, d3ccek1, d3ccel1, d3ccen1, d3cceo1, d3ccep1, d3cceq1, d3ccer1, d3cces1, d3ccet1, d3cceu1, d3ccev1, d3ccew1, d3ccex1, d3ccez1 automatically matched to d1jj2x_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant |
PDB Entry: 3cce (more details), 2.75 Å
SCOP Domain Sequences for d3ccey1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccey1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Archaeon Haloarcula marismortui [TaxId: 2238]} telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr erieeeaedagirvlnptyvev
Timeline for d3ccey1: