![]() | Class i: Low resolution protein structures [58117] (26 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.2: Large subunit [58124] (1 protein) |
![]() | Protein 50S subunit [58125] (6 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
![]() | Domain d3ccex1: 3cce X:7-88 [156281] Other proteins in same PDB: d3cce21, d3cceb1, d3ccef1, d3cceh1, d3ccei1, d3ccep1, d3ccer1, d3cces1, d3ccey1, d3ccez1 automatically matched to d1w2bw_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3; mutant |
PDB Entry: 3cce (more details), 2.75 Å
SCOP Domain Sequences for d3ccex1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ccex1 i.1.1.2 (X:7-88) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]} ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant pskirvraarfeeegeaiveae
Timeline for d3ccex1: