Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (1 protein) |
Protein 50S subunit [58125] (6 species) |
Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
Domain d3cceq1: 3cce Q:1-95 [156274] Other proteins in same PDB: d3cce21, d3cceb1, d3ccef1, d3cceh1, d3ccei1, d3ccep1, d3ccer1, d3cces1, d3ccey1, d3ccez1 automatically matched to d1w2bp_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3cce (more details), 2.75 Å
SCOPe Domain Sequences for d3cceq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cceq1 i.1.1.2 (Q:1-95) 50S subunit {Haloarcula marismortui [TaxId: 2238]} pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt gtvegkqgdaykvdivdggkektiivtaahlrrqe
Timeline for d3cceq1: