Lineage for d3ccen1 (3cce N:1-186)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2648151Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2648286Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2648433Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 2648525Domain d3ccen1: 3cce N:1-186 [156271]
    Other proteins in same PDB: d3cce21, d3cceb1, d3ccef1, d3cceh1, d3ccei1, d3ccep1, d3ccer1, d3cces1, d3ccey1, d3ccez1
    automatically matched to d1w2bm_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccen1

PDB Entry: 3cce (more details), 2.75 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
PDB Compounds: (N:) 50S ribosomal protein L18P

SCOPe Domain Sequences for d3ccen1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccen1 i.1.1.2 (N:1-186) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOPe Domain Coordinates for d3ccen1:

Click to download the PDB-style file with coordinates for d3ccen1.
(The format of our PDB-style files is described here.)

Timeline for d3ccen1: