SCOPe 2.04: Domain d3ccei1: 3cce I:66-129

Lineage for d3ccei1 (3cce I:66-129)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries)
   Uniprot P14122 67-136

8. Domain d3ccei1: 3cce I:66-129 [156267]
   Other proteins in same PDB: d3cce11, d3cce21, d3cce31, d3cceb1, d3cced1, d3ccef1, d3cceh1, d3ccej1, d3ccek1, d3ccel1, d3ccen1, d3cceo1, d3ccep1, d3cceq1, d3ccer1, d3cces1, d3ccet1, d3cceu1, d3ccev1, d3ccew1, d3ccex1, d3ccey1, d3ccez1
   automatically matched to d1s72i_
   complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccei1

PDB Entry: 3cce, 2.75 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a

PDB Compounds: (I:) 50S ribosomal protein L11P

SCOPe Domain Sequences for d3ccei1:

Sequence; same for both SEQRES and ATOM records:

>d3ccei1 a.4.7.1 (I:66-129) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tcts

Timeline for d3ccei1:

• d3ccei1 first appeared in SCOP 1.75
  
• d3ccei1 appears in SCOPe 2.03
  
• d3ccei1 appears in SCOPe 2.05
  
• d3ccei1 appears in the current release, SCOPe 2.08